SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000007190 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000007190
Domain Number 1 Region: 194-425
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-77
Family SSRP1-like 0.0000101
Further Details:      
 
Domain Number 2 Region: 530-610
Classification Level Classification E-value
Superfamily HMG-box 2.49e-25
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000007190
Sequence length 703
Comment (Taeniopygia guttata)
Sequence
MADTLEFNEIYQEVKGSMNDGRLRLSRQGVIFKNSKTGKVDNIQASELAEGVWRRVALGH
GLKLLTKNGHVYKYDGFRESEFDKLSDFFKAHYCLELAEKDLCVKGWNWGTVRFGGQLLS
FDIGEQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEA
FAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISQVPPIKLGQEVFHFVILFSQNDISLSLNMNEEEVEKRFEGRL
TKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFIYV
HKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNAKK
LNIKNRGLKEGMKQSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDGSGEETDSSF
NPGEEDDDVAEEFDSNASASSSSGDGDSDRDDKKPAKKAKIVKDRKPRKKQPESKKGKDP
NAPKRPMSAYMLWLNANREKIKSDHPGISITDLSKKAGELWKAMSKEKKEEWDRKAEDAR
RDYEKAMKEYSVGSKADSHRGEKSKKKKKKQEKQVKGKGDKKGATSKSSSSKSPAKGMSD
SFKSKEFVSSDESSSAESKKEDSEDEGAASPAPSSEDSASGSD
Download sequence
Identical sequences H0Z9D7
ENSTGUP00000007190 ENSTGUP00000007190 59729.ENSTGUP00000007190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]