SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000008229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000008229
Domain Number 1 Region: 10-199
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.93e-74
Family Glutathione peroxidase-like 0.0000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000008229
Sequence length 201
Comment (Taeniopygia guttata)
Sequence
IKMSSGKAFIGKPAPDFTATAVMPDGQFKDIKLSDYRGKYVVFFFYPLDFTFVCPTEIIA
YSDRADEFKKINCEVIGASVDSHFCHLAWINTPKKQGGLGTMKIPLISDTKRAIAKDYGV
LKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWK
PGSDTIKPDVQKSKEYFAKQK
Download sequence
Identical sequences H0ZCB9
ENSTGUP00000008229 59729.ENSTGUP00000008229 ENSTGUP00000008229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]