SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000008580 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000008580
Domain Number 1 Region: 1830-1987
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-44
Family C-type lectin domain 0.000000743
Further Details:      
 
Domain Number 2 Region: 147-256
Classification Level Classification E-value
Superfamily C-type lectin-like 7.09e-43
Family Link domain 0.0022
Further Details:      
 
Domain Number 3 Region: 515-624
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-38
Family Link domain 0.0013
Further Details:      
 
Domain Number 4 Region: 625-729
Classification Level Classification E-value
Superfamily C-type lectin-like 4.97e-32
Family Link domain 0.0042
Further Details:      
 
Domain Number 5 Region: 258-351
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-27
Family Link domain 0.003
Further Details:      
 
Domain Number 6 Region: 1988-2048
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000118
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 7 Region: 34-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000126
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000008580
Sequence length 2077
Comment (Taeniopygia guttata)
Sequence
MTTLLLVFVCLQVITAADSVELSDSSDGLEVKIPEQSPLRVILGSSLNIPCYFNIPEEQD
TSVMLTPRIKWSKLSNGTEVVLLVATGGKIRLNSEYREVISLPNYPAIPTDATLEIKALR
SNHTGIYRCEVMYGIEDRQDTIEVLVKGIVFHYRAISTRYTLNFEKAKQACIQNSAVIAT
PEQLQAAYEDGYEQCDAGWLADQTVRYPIHWPRERCYGDKDEFPGVRTYGVREPDETYDV
YCYAEQMQGKVFYATAPEKFTFQEAFDKCRSLGARLATTGELYLAWKDGMDMCSAGWLAD
RSVRYPISRARPNCGGNLVGVRTVYLYVNQTGYPHPDSRYDAICYGGDDIESLVPGQFID
ELGSELGSAFTVQTVTQTEVELPLSRNATEEEARGSIATLEPMEITPTATRLDEGFTALP
DLFTTAGTAETAATEEENVTREDVTAVWTVPEEATTFGTASTSETAEVSSVEEVVGVTAT
PGLESASVFTVEDQLVRVTAAPGAGHLPEQPISPTGVVFHYRAATSRYAFSFVQAQKACL
ENSAVIATPQQLQAAYEAGFDQCDAGWLRDQTVRYPIVNPRNNCIGDKENTPGVRSYGMR
PASETYDVYCYIDRLKGDVFFATQPEQFTFPEAQQYCESQNASLASVGQLHAAWKQGLDR
CYAGWLADGSLRYPIVSPRPACGGDAPGVRTVYQHHNQTGFPDPLSRHHAFCFRALPPVE
EEGVTPFFEDVLATQVIPGVEGVPSGEEVTMETESATQPENQTAWGTEVFPTDVSLLSGG
PSAFPPATIGPEETSTNASVSEVPEGVTESGEHQVSGESPAPGWVPGVPDTSGEPTSGVF
ELSGDHSGTGESGLPSVDLHASGFPPGGSGLPSGDLSGVSSGVVDISGLPSAEEEMSVSI
SRIPEISGMPSEVERSKLHFGSSGEISGTELVSGVSSGEESGVTSGFPTVSLVDTTLVEV
VTAVTERQEEGKGSIGVSGEGDLSGFPSSEWDSSGGVQGLPSGAEPSGESSGVPELSGLS
SGGSELSGLPSGLDASGETSGTHEISGLVDLSGLSSGIEGSSETSGITFVDATLEAVTTT
SPITGAEAKETLETSGLPSGEEDGSGNVSGSLDISGEPSGHVDFGGSVSGVLEMSGYPSG
VTDSSGDISGVDVTSGLLSGEESGLTSGFPTVSLVDTTLVEVVTQTSMAQEVGEGPSGVI
EISGFTSGDRGLSGEGSGAVETSGFPSGSGDLSEEPSGIPYISGDFSGATDLSGQSSTVA
DISGEASGILGITLVTSDLVEVVTRPTVSQELGGETVTFPYSLGPSGEASGSGELSGETS
ALPESALETSTAYEISGETSAFPETGIETSTIHEISGEASAFPEFNTETSTIQEISGETS
AFPEISTETSTSQETSGETSAFPESSTETSTIQEISGETSAFPEIRIETSTSQDISGETS
AFPEIRIETVTSQEARGEISGYPEISIETSTVHETSGETSAFPEISIETSTVHEISGESS
AFPEIRIETYTNQEARGETSAYPEISIETSTVHETSGETSAFPEISIETSTVQKISGDMS
SFPEISIETSTVHETSGEIPAFPEIRIETSTGEEARGETSVFPEISIETSTVHDISGETS
AFPEFSIETSTSQEARSETSANPEIFIETSTVQEASGETSAFPEIRIGTPTSQEARGETF
PEISIEASTVHETSGEASALPAANVKTAATSLGSREPFGTPEESPDTTSGAVTHSIAGIS
RETSVPDVVISTRTPDVEPTQGLRNPEEAQLDMEPSPPVVSEQETETAVAPDNPHLLATT
TAALPQVSQEAIDTLGPTTEDTDVCHSSPCLNGATCVDGIDSFKCFCLPSYGGDLCEIDS
EKCEEGWTKFQGHCYRHFEERETWMDAETRCRQHQAHLSSIITPEEQEFVNSHAQDYQWI
GLSDRAVENDFRWSDGHSLQYENWRPNQPDNFFSAGEDCVVMIWHEKGEWNDVPCNYHLP
FTCKKGTVACGDPPAVENARTFGRKKERYEINSIVRYQCDQGYIQRHVPTIRCQPSGQWE
QPRISCLNPSSYQRRLYKRSPRSRSKPSGSAVHRRTH
Download sequence
Identical sequences H0ZDB8
ENSTGUP00000008580 ENSTGUP00000008580 59729.ENSTGUP00000008580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]