SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000008665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000008665
Domain Number 1 Region: 859-1069
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-54
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 1232-1418
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-26
Family Pleckstrin-homology domain (PH domain) 0.0000123
Further Details:      
 
Domain Number 3 Region: 1058-1179
Classification Level Classification E-value
Superfamily PH domain-like 3.27e-25
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000008665
Sequence length 1422
Comment (Taeniopygia guttata)
Sequence
FPSFLEIKKPPVAPKPKFVLGHKAAPPPVAPKPDIVLSGGIQAARKTKPAIAPKPKVLKS
SSIPEVKPPSSTRKSTKSFEEHREDSSQTLDRLNYKNETSEGSTGNTAYILPVSPCRFGC
LHKLGNGENTRKTQIILEHFDTLENIKLDERNALSLGDSHNEKLASRSQVVLKASILEEK
LKDVLTHSVFPNSSPVRHRYADKFDKGNGSSSKNDVKIEFMELVQSPSSSEIVQGKQQNT
DGKIIADEFQMSEICPSLIENNHSCSSPLDKETLENENLSRHWMFSGEVAMKADFLSSKV
LPIPKPRKPRAACLVRQDGIDSTGEGTKEPSNLETDSYSVVDQSLKKPARINVLGQSVCY
NNNAEVLNPEKCEVTQSNAEKMSQQVKEPAVKESDSQNLLPQFSHRSPDSVRHVESSLNA
DHNFMDEITDDTSMPDAVEKRTNFVRCDALSMSLPKQLKLASSQYSLAANSLHVSPQNLE
NKEVKIKDESSPKVIPKKPQRHGLPAAGLLKKAASAELVDKSSYTSSEDKSNSLLEGSHF
AHPRAKEQDALLSCDIPKRSSEKPVWKLPHPILPFSGNSESLKSATSFSHLTVVTKPRAK
SLSAVDMDRTDKPCKDHHKKNSFKKLLNMKLSVCLKKSDFQKFLSKGSQSVESAVASISS
GNGYGNSSNIGSVGCERKAKSAKAHSIEISSPALQKKRQRNRSQSEMQNNPRLESLDRRG
LLGENWSQMPLNYVTSTCDPEYENVRHYEEIPEYENLPFALGARGNLCSEWQNSSSVEDQ
STDFCEVEEPCEATTRRWRLDRLFSASAQEMCEHLLFEHPNQSDEEDIMNSSDEDDDTNS
DSSKGETDPQEDKQGKAAGKKTKVYHIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQL
GKPVIEDRILNQILYYLPQLYELNRDLLRELEERLSHWLEHQRIADIFVKKGPYLKMYST
YIKEFDKNVALLDEQCKKNAGFASVVKDFEMSPRCASLALKHYLLKPVQRIPQYRLLLTD
YLKNLLEESADYRDTQDALAVVIEVANHANDIMKQGDNFQKLMQIQYSLNGHHEIVQPGR
VFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVKKPTQEAY
QNELNIESVERSFILSASSATERDEWLEAISKSIEEYTKKRITFNPSKSLEEADAEKQEE
DSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKHGLDYMKNQ
PARVCDHCFRELQKQDNQCTPKSGSPVNHKSPSSALSTVLQSIPSGRKQKKIPAALKEVS
ANTEDSTMSGYLHRSKGSKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVSEVK
GENSESRVFHLLHKNTLFYIFKADDPHSAQKWIEAFQEGTVL
Download sequence
Identical sequences H0ZDK3
ENSTGUP00000008665 ENSTGUP00000008665 59729.ENSTGUP00000008665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]