SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000008846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000008846
Domain Number 1 Region: 692-976
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.89e-71
Family Tandem AAA-ATPase domain 0.000027
Further Details:      
 
Domain Number 2 Region: 422-690
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.14e-58
Family Tandem AAA-ATPase domain 0.0000355
Further Details:      
 
Domain Number 3 Region: 252-342
Classification Level Classification E-value
Superfamily Chromo domain-like 3.56e-20
Family Chromo domain 0.0000437
Further Details:      
 
Domain Number 4 Region: 347-438
Classification Level Classification E-value
Superfamily Chromo domain-like 7.46e-18
Family Chromo domain 0.0000724
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000008846
Domain Number - Region: 1250-1282
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000247
Family Homeodomain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000008846
Sequence length 1821
Comment (Taeniopygia guttata)
Sequence
MMRNKDKSQGEEGSVHSNASSHSASEEASGSDSASQSESEQGSESNSSSESSESQSESES
ESTGSKSQQTPPETKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPSRFNIKDEA
SSESENESPKRRRQKQLKRKEVSAGEEDEDGGEQGTCESEPEPKKIKRRPVQRRLIPSEK
VAELQSQRGKRKKQDSSEDDDDDEDDETPKRQTRRRAAKNVSYKEDDDFETDSDDLIEMT
GEGADEQQDNSETIEKVLDIRLGKKGAIGASTTVYVTEANGNPSADFDPEKDEGEVQYLI
KWKGWSYIHSTWESEESLQQQKVKGLKKLENFKKKEEEIKQWLGKVSPEDVEYFNCQQEL
ASELNKQYQIVERVIAVKTSKSATGHSDFPANSRKSSSNDPEYLCKWMGLPYAECSWEDE
ALISKKFQHCIDSFNSRNNSKTIPTRDCKVLKQRPRFVALKKQPSYIGGENLELRDYQLE
GLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLVVVPLSTLTSWQR
EFEVWAPEINVVVYIGDLMSRNMIREYEWIHSQSKRLKFNALITTYEILLKDKTVLGSIN
WAFLGVDQAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEF
WEDFEEDHGKGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYK
WILTRNYKALSKGTRGSTSGFLNIVMELKKCCNHCYLIKPPEENERENGLETLQSLIRSS
GKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQAL
DHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQV
NIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNNSGRSNSNPFNKEELTA
ILKFGAEDLFKELEGEESEPQEMDIDEILRLAETRENEVSTSATDELLSQFKVANFATME
EEETELDERSQKDWDDIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKAQTNDSESDA
ETKRRLQRSSGSESETDDTDDEKRPKRRGRPRSVRKDTVEGFTDAEIRRFIKAYKKFGLP
LERLECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKENPAEGKGPGKRRGPT
IKISGVQVNVKSIIQHEEEFEMLHKSIPSDPEERKKYRLTCRVKAAHFDVDWGVEEDSRL
LVGIYEHGYGNWELIKTDPELKLSDKILPVETDKKPQGKQLQTRVDYLLKLLKKDLDKKE
NMKDGEEGKLKKRKPRVKKENKAPKVKDEHGNELSSPRHSDNQSEEGEVKEDGLDKSPVK
KKQKKKENKENKEKQTSSKKEKESDKEKKKTKDKKEKPKGGEAKSGSKGKRSQGPVHITA
GSEPIPIGEDEDDDLDQETFSICKERMRPVKKALKQLDKPDKGLTVQEQLEHTRNCLLKI
GDRISECLKAYNDQDHIKLWRRNLWIFVSKFTEFDARKLHKLYKMAHKKRSQEEEEQKKK
EDMSNMKKQFRPEPSGSSRDSVMSQSHVPHNPHSQKIHMPPSHTQQQMHGHPRDNYGHPN
KRHFSNTDRGDWQRDRKFNYGGNSNQMWGGERHHQYEQHWYKDHHYGDRRSRGDPHRSSG
NYRPNNLSRKRPYEQYNSDRDHRGHRDYYDRHHHDSKRRRSDDFRPQNYHQQDFRRMSDH
RPPMGYHGQGPSDHYRSFHTDKLGDYKQPLPPSHPAVSDPRSPPSQKSPHDSKSPLDHRS
PLDRSLEQKNNPDYNWNIRKA
Download sequence
Identical sequences H0ZE34
ENSTGUP00000008846 59729.ENSTGUP00000008846 ENSTGUP00000008846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]