SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000009711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000009711
Domain Number 1 Region: 19-130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-30
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 224-339
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-16
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 3 Region: 138-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000511
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 4 Region: 418-456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000929
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 5 Region: 183-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 379-417
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000759
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 341-378
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000009711
Sequence length 603
Comment (Taeniopygia guttata)
Sequence
VNLFLTGKIESAVTSLAACSGELEQHTERRGVIYSPSWPSNYPPAINCSWYIQGDHGDMI
TISFKNFDLEDSQKCAVDWLMIGPSSKREEYKVCGSSIPPSFISARDHVWIFFHSDASSS
GQAQGFRLSYIRGKIGQSVCQSDEFHCANGKCIPSTWKCNSMDECGDNSDEKNCTVPPTD
PPSSICPSGMFQCSAGHSTKCLMNELRCNSVKDCGDGSDEDNCPDLSCGKRLGNFYGSFA
SPDLFRADHSRSDLRCTWYVDTQDNRHVLLQLDLQLGYNDYVKVYDGIGERGDKLMQTFS
HHNNRHSVSVESSKGQLTVSYHARSKSTGHGFNATYQVKGYCLPWEHPCGSDEECFTDKQ
HCDGWWHCPNGKDEENCPACQKNEYPCEGNSGLCYSILDRCNNQKNCPDGSDEKNCFTCQ
PGNFHCGTNLCIFETWRCDGQEDCQDGSDERNCLVIVPRKVITAALIGSLVCGLLLVIAL
GCAFKLYSLRTREYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYNASQV
SVLQNIRTAMRRQMRRHAARRGSSRRRLGRLWGRLFHRPRGRGQIPLLPPARASQTTLGD
GII
Download sequence
Identical sequences H0ZGJ9
ENSTGUP00000009711 59729.ENSTGUP00000009711 ENSTGUP00000009711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]