SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000009917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000009917
Domain Number 1 Region: 446-604,683-814
Classification Level Classification E-value
Superfamily L domain-like 2.72e-54
Family Ngr ectodomain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 1-203
Classification Level Classification E-value
Superfamily L domain-like 2.72e-42
Family Ngr ectodomain-like 0.00087
Further Details:      
 
Domain Number 3 Region: 212-418
Classification Level Classification E-value
Superfamily L domain-like 5.95e-42
Family Ngr ectodomain-like 0.00026
Further Details:      
 
Domain Number 4 Region: 1083-1272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-41
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 937-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000399
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 1011-1052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000377
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 7 Region: 854-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000439
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 8 Region: 897-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000336
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 9 Region: 976-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000545
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 1268-1308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000068
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 1352-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000757
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000009917
Domain Number - Region: 1311-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000452
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000009917
Sequence length 1468
Comment (Taeniopygia guttata)
Sequence
DLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNNLQLLSE
LLFLGTPKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVL
TLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPS
HLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPTACTCSNNIVDCRGKGLTEIPTNLPE
TITEIRLEQNSIKVIPPGAFSPYKKLRRIDLSNNQISEAAPDAFQGLRSLNSLVLYGNKI
TELPKGLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLR
AIQTLHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSA
KEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPDHIPQYTAELRL
NNNEFSVLEATGIFKKLPQLRKINLSNNKITDIEEGAFDGASGVNELLLTSNRLESVQHK
MFKGLESLKTLMLRSNRVSCVGNDSFTGLSSVRLLSLYDNQITTVAPGSFDTLHSLSTLN
LLANPFNCNCHLALGDWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSC
SPLARCPAECTCLDTVVRCSNKGLKALPKGIPKDVTELYLDGNQFTLVPKELSNYKHLTL
IDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPARTFDGLKSLRLLSLHGNDISVVP
EGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTP
SKKFTCQGPVDVNILAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDIPIHAC
ISNPCNHGGTCHLKEGEKDGFWCTCADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYT
CLCPPEYTGELCEEKLDFCAQNLNPCQHDSKCILTPKGYKCDCTPGYVGEHCDIDFDDCQ
DNKCKNGAQCTDAVNGYTCVCPEGYSGLFCELSPPMVLPRTSPCDNYECQNGAQCIIKES
EPICQCLSGYQGEKCEKLISINFVNKESYLQIPSAKIRPQTNITLQIATDEDSGILLYKG
DKDHIAVELYRGRVRVSYDTGSYPASAIYSVETINDGNFHIVELLAMDQILSLSIDGGSP
KTITNLSKQSTLNFDSPLYVGGMPVKNNIAALRQSPGQNGTSFHGCIRNLYINSELQDFR
NVPLQVGILPGCEPCHKKVCVHGTCHATSQSGFSCECEGGWTGPLCDQQTNDPCLGNKCV
HGTCLPINAFSYSCKCLQGHGGVLCDEEEMLLNPCQSIKCKHGKCRLSGLGKPYCECSSG
YTGDSCDKEISCRGERVRDYYQKQQGYAACQTTKKVSRLECKGGCSAGQCCGPLRSKRRK
YSFECTDGSSFVDEVEKVVKCGCTNCPS
Download sequence
Identical sequences H0ZH52
ENSTGUP00000009917 ENSTGUP00000009917 59729.ENSTGUP00000009917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]