SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000010276 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000010276
Domain Number 1 Region: 90-270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.19e-38
Family Laminin G-like module 0.00000442
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000257
Family Laminin G-like module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000010276
Sequence length 274
Comment (Taeniopygia guttata)
Sequence
MEYVKRKGTIIVDGQDLVAVNALGDGSTLDVEGKLYVGGLPLDYVPKNLGNVSHSIPACI
GSMTINGNQVDNESPVSIFAVNKCYETVQDGTFFDGSGFAALAREGYKVRSDVNITLEFR
TTAVHGVLLGVSSTKVDAIGLEIVHGKVLFHVNNGAGRITATYEPRGTNSLCDGKWHKLQ
ANKSKHHISLIIDGNLVHTDNPYVHSTSADTNNPIYVGGYPADVKQNCLTSKSSFRGCLR
NLVLTKGQHTELFDFSRAFDLRGVFPHSCPGAEH
Download sequence
Identical sequences H0ZI59
59729.ENSTGUP00000010276 ENSTGUP00000010276 ENSTGUP00000010276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]