SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000010612 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000010612
Domain Number 1 Region: 45-389
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-86
Family Protein kinases, catalytic subunit 0.00000203
Further Details:      
 
Domain Number 2 Region: 919-985
Classification Level Classification E-value
Superfamily G protein-binding domain 1.2e-22
Family RhoA-binding domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1091-1181,1260-1292
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000185
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 1200-1257
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000942
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Domain Number 5 Region: 397-499
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000131
Family Myosin rod fragments 0.0023
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000010612
Domain Number - Region: 538-785
Classification Level Classification E-value
Superfamily Tropomyosin 0.000719
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number - Region: 982-1071
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0445
Family Myosin rod fragments 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000010612
Sequence length 1328
Comment (Taeniopygia guttata)
Sequence
CFQDGLDALVYDLDFPALRKNKNIDNFLNRYKDTVNKMRDLRMKAEDYEVVKVIGRGAFG
EVQLVRHKSSRRVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRY
LYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDK
AGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFL
YEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDSDISKEAKNLICAFLTDREVRLGRNG
VEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFV
GNQLPFVGFTYYSNRRYVRRKQINGVHHYLKISHCVLENMQKMIYELEEQLHNEMQLKDE
MEQKCRSSNIKLDKIMKELDEEGNQRKNLETTVSQIEKEKMVLQHKINEYQRKFEQENEK
RRNVENEVSTLKDQMEDLKKISQNSQISNEKITQLQKQLEEANDLLRTESDTAARLRKGN
TEISKSLSQVESLNRELQERCRVLESTKLQVEKDYYQLQAALESERRDRSHGSEIIGELQ
VRITALQEEVKNIKNNLERVEAERKQAQDMLNHSEKEKNNLEIDLNYKLKSLQDRLEQEV
NEHKVTKARLTDKHQSIEEARSVAMCEMEKKIREERAAREKAENRIVQAEKQCSMLDFDL
KQSQQKLEHLLQQKERLEDEVRNLTLKLEQETNKRIMAQNELKAQAFEADNLKGSEKQLK
QEINTLLEAKRLLEFELAQLAKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEID
ERNKETQRKMQELQNEKETLATQLDLAETKAESERLARALAEEQYYELNQESKKAASRHR
QELTDKDIIIRRLEETNNTLTKDVDLITKENTEISEKFKKQEEDYKMKKEEEISNIRMHY
EKSINTERTLKTQAVNKLAEIMNRKDFKIDRKKANMQDLRKKEKENRKLQLELNQEKEKF
NQMVVKYQKELNEMQAQLAEESTYRNELQMQLDSKESDIEQLRRKIMDLQQGMDSTSVAS
LPTDETDGNLSESRLEGWLSVPNKGNIRRHGWKKQYVVVSSKKILFYNDEKDKDQSNPSM
VLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDLEVEPVQPAEKTNFLNH
KGHEFIPTLYHFPANCEACAKPLWHVFKPPAALECRRCHVKCHRDHLDKKEELIAPCKVS
YDVTSARDMLLLASCQDEQKKWVTHLVKKIPKTPPSTFVRASPRTLSTRSSANQSFRKVV
KNTSGKTR
Download sequence
Identical sequences H0ZJ44
59729.ENSTGUP00000010612 ENSTGUP00000010612 ENSTGUP00000010612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]