SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000011009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000011009
Domain Number 1 Region: 117-253
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.0002
Further Details:      
 
Domain Number 2 Region: 353-455
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-16
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 233-327
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000485
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 48-129
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000871
Family Cadherin 0.0026
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000011009
Domain Number - Region: 461-556
Classification Level Classification E-value
Superfamily Cadherin-like 0.00871
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000011009
Sequence length 822
Comment (Taeniopygia guttata)
Sequence
VKEWDENGMARWKTFRRQKREWIKFAAACREGEDNSKRNPIARIRSDCEEDNPITYSISG
VGIDRAPYGIFVVNPRTGEINITSVVDREITPVFVIRCFAKHSVTGIDLEPPLELRVRVL
DINDNPPVFAQTVFTGSVEESSMDNTLVMKIIATDADEPNHLNSKIAFKIESQEPSGPPM
FIMNKYTGELHLANYLDREQHSSYTLVVKASDRDGAADGISSLCSCNVKVIDVNDNFPTL
AQSSFSTSISENSLSSELLRIQALDADEEFTDNWLAEFFFISGNEDNCFEIVTDRATNQG
ILRVIKELDFEHMRTHSLMIGVRNVAAFHHSVAHEYQIFGTPLTVEVKNLIEPPRFHPSS
IVFSLAEGARVNYVLGTYTAMDEDTRTIASNVVYSIGRDPAAWFRINQNTGEITLNKVIN
RDSVYIVNGQYQAEVLAITRGTPRYTATGTVVLSIDGINANCPTINTEMRKVCMNSPSVI
ISAKHRNGDLYATPFTFSIHGEPQTTWIIRRINDSSAELVGQNIDFYLYRIYVVVRDSQG
RRCAQPHIIPVQACQCDSRNYCTSGATRIIIIGGGGGSGGGTGGGTGGGTGGGTIGGGGG
GTDRLIGYLVRNILKAYFQDDCCGCGPGAAGGVGTGFEPVPECTEGAIHPWGIEGAQPED
RDVSHILAPTTAAGGDFGEPSDIYNNTYGGGGVVASGVEETTGVGYGTGTGYGTAGGISG
TGEAKGSIGGTIKEYREGGVNMAFLDNYFSEKAFVYADEDEGRPANDCLLIYDHEGVGTP
VGSVGCCSFIGEDTDETYLDTLGPKFKTLAEICLGKEIEPFP
Download sequence
Identical sequences H0ZK89
ENSTGUP00000011009 59729.ENSTGUP00000011009 ENSTGUP00000011009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]