SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000011136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000011136
Domain Number 1 Region: 7-227
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.47e-76
Family STAT DNA-binding domain 0.000000292
Further Details:      
 
Domain Number 2 Region: 779-989
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-74
Family STAT DNA-binding domain 0.0000000225
Further Details:      
 
Domain Number 3 Region: 599-779
Classification Level Classification E-value
Superfamily STAT 5.89e-57
Family STAT 0.000000204
Further Details:      
 
Domain Number 4 Region: 463-581
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 7.06e-45
Family Transcription factor STAT-4 N-domain 0.0000125
Further Details:      
 
Domain Number 5 Region: 990-1131
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-43
Family SH2 domain 0.000000185
Further Details:      
 
Domain Number 6 Region: 228-343
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-38
Family SH2 domain 0.00000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000011136
Sequence length 1171
Comment (Taeniopygia guttata)
Sequence
LTYDGDPIPVQRPQLLEKVNFLLYNLFRKLLIKLPELNYQIRVKATIDNNRRFVLCGTHV
KAMNMDESANGSLSVEFRHLGPHMVTEELHSISFETQVCLYGLTINLETSSLPVVMISNV
SQLPNAWASIIWYNLSTNDPQNLSFFNNPPAATLSQLLEVLSWQFSSYVGRGLNSEQLNM
LAEKLVGKFSYNDYQLSWAKFCKEHLPGKSFTFWVWLEAILDLIKKHILPLWIDGYVMGF
VSKEKERILLKDKTPGTFLLRFSESNLGGITFTWVDQLENGDVTFHSVEPYNKGRLSALP
FADILRDYKVIMADNVPENPLKYLYPDIPKDKAFGKHYSCQPNEGRGSISLLTLPAQQLQ
TSFCKYISKFCPYATMNLLRFCHEDLPPPSEGRGTDYPGVPQQSPDFSIPLFAGSQHQTK
PRRATLDRETATRMDTIPASRAWVQSEYYYNIYTDFFFTPSRMSQWYQLQQLDSKFLEQV
HQLYDDSFPMEIRQYLAQWLENQDWEHAANNVSFATLLFHDLLSQLDDQFSRFLIENNFL
LQHNIRKSKRNLQDNFQEDPIHMAMIIHNCLKEERKILSCAKACNEMEVGSVQNTATGMP
DKQKELDTNIRTLKSDVNDVEQDIKALENLQDEYDFKCKTLQNREHESSSMSQEEYKKEQ
LNLQHMFLSLDHRRKDVVSAIVKLLQSTEQVQAALINDELVEWKHRQQTACIGGPPNACL
DQLQNWFTIVAESLQQVRQQLKKLEELEQKFTYDPDPITKNKQFLQDLTNKLFQQLIQRL
LVKLQELNYNLKVKVLFDKDVTEKNSVKGYVASEFNFSFSLCRFRKFNILGTNTKVMNME
ESTNGSLAAEFRHLQLKEQKNTGSRTNETTSLPIVVISNVSQLPSGWASILWFNMLSTDP
KNLSFFLNPPSAKWSKLADVLSWQFSSVTKRGLNADQLSMLGEKLLGPSNGGSQDGLIPW
TRFCKENINDKNFPFWLWIEGILELIKKHLLCLWNDGCIVGFISKERERALLKDQSPGTF
LLRFSESSREGAITFTWVEESQNGKEPLFHSVEPYTKKELSAVTFPDIIRNYKVMAAENI
PENPLRFLYPNIPKDNAFGKYYSRPKEAPEPMDLDGPKGNGYIKTELISVSEVHPSRLQS
PENLLPMSPEEFDEVSRMVGPAEIDTVVRTR
Download sequence
Identical sequences H0ZKL5
ENSTGUP00000011136 59729.ENSTGUP00000011136 ENSTGUP00000011136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]