SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000011720 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000011720
Domain Number 1 Region: 642-807,856-1006
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-81
Family Protein kinases, catalytic subunit 0.00000155
Further Details:      
 
Domain Number 2 Region: 98-138
Classification Level Classification E-value
Superfamily UBA-like 9.19e-18
Family UBA domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000011720
Sequence length 1082
Comment (Taeniopygia guttata)
Sequence
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSGQGLPIGAGSETSLDPKILIGKDAARQ
QQMRQTPKFGPYQKALREIRYSLLPFANESSTTAAVEVNRQMLQELVNAGCDQEMAVRAL
KQTGSRSIEAALEYISKMSYLDPRNEQIVRVIKQTSPGKGIVPNNVTRRPSFEGSNESFP
SYHQIGNAAYEGTGFGAEGANMLTEVPRPYMDYLISTSQSSAMTAPVQRPSGKAYPANME
SSVINYPLQVQHYSRQHMMVQGEPMGYGVQRSPSFQNKMQQEGGYASLQNKGAVVQNNTG
HAFQQAPASLYISHSHHKQTSPSSHQMHVISRGPAFANDFSDSPPQNLLTPSRNSLNMDL
YDMNNPQVQQWQAAAPSRRDSVQNPGIETSPRQHVSFRPDATVPSRTNSFNNHQQQPQVP
PGKPDPSITSPNTITAVTSAHILQPVKSMRVMRPEPQTAVGPSHPAWLPAQAPAVDGLEI
MEQHVPPPGAANAYQLDVDYGNQELRCPPPPYPKHLLLPGTSEQFDINCLCKGMEQTLRV
VPKSSERNDKSSKNTKAEKPSKDKKQIQTSPVPVRKNGKDEEKRESRIKSYSPFAFKFYM
EQHVENVIKTYQQKMNRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKS
MFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNE
WVVKLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMG
FIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHIRQDSMEPSDLWDDVS
NCRCGDRLKTLEQRAKKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEM
LVGQPPFLAPTPTETQLKVINWESTLHIPSQIKLSPEATDLITKLCCAAEDRLGRNGADD
IKAHSFFHSMDFSTDIRRQPAPYVPKISHPMDTSNFDPVEEESPWSDASGDSTRTWDPLA
SSNSKHTEHAFYEFTFRRFFDDNGYPFRYPKPSGMEVCQSEKSDVEDKGVVDQTGACQPV
YV
Download sequence
Identical sequences H0ZM97
ENSTGUP00000011720 ENSTGUP00000011720 59729.ENSTGUP00000011720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]