SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000012202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000012202
Domain Number 1 Region: 444-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000309
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 477-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000012202
Sequence length 519
Comment (Taeniopygia guttata)
Sequence
PTGDLRKAKRQDKYFKYSSFHPLHGPAQRHSESFAYFFPEDYFEGVRMKFPLSWPTPNGL
TATKAQEICHQILAHSTIGLACKGLLAKHLDEAIDICLLDLQLKDDVAWVRALIALLENE
CERRVLGSRKGEFPVGNQPSASWEEILAALRCPALCSGRGRCTELGCRCLGGHSSYDCSI
AQKQALEITALENGGLCDVRASDCSRIRAFGLGFKESPSLHCQVTRLIHLNGKWMSREEE
STKADFLSSEAVDCQIPLLNITEAVHFVAGDEPLARWQVKITNDGLQYSNSRVLTLYDAV
CQVCQFHPAGLCKLKENTCNIDGLCYGEGESSPTSPCLLCEPVISKFTWSVNENNLPPVF
QAPSSQLLTFIGENFVYQLIAVDPEGSAVLFILEAGPRGARLSPAGLLLWKVESEEVQTF
EFTVSDECNAQRRYSVEVGVKPCSCLNGGTCVTNIKYPPGLGEYLCLCPNGFDGEFCQED
IRDCKSNPCGSGTCVDSVGSYFCKCPPGLGGNTSLFASL
Download sequence
Identical sequences H0ZNM5
ENSTGUP00000012202 ENSTGUP00000012202 59729.ENSTGUP00000012202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]