SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000012926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000012926
Domain Number 1 Region: 130-249
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 236-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000247
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 10-65,103-152
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000148
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000012926
Domain Number - Region: 278-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00296
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000012926
Sequence length 439
Comment (Taeniopygia guttata)
Sequence
RILTAFTLAVCLSSPGKAQQQCTNGFDLDRASGQCLDIDECRTIPEACRGDMVCVNQNGG
YLCVPRTNPVYRSPYLSPYSNVYPPPPAPGPVPNYPTVTRPLMCRFGFQLDENNQCADVD
ECASDSHQCNPTQICINTEGGYTCSCTEGYWLLEGQCIDIDECRYGYCQQLCANVPGSYS
CTCNPGFTLNDDGRSCQDVNECTSENPCTQTCVNTYGSFLCRCEPGYELEADGVNCSDMD
ECSFSEFLCQHECVNGPGSYYCTCPSGYNLLDDSRSCQDINECEIRNFTCTSQQTCFNIP
GEYKCLDPVRCEEPYLQINENRCMCPAENPGCRDQPFTILYRVMDMVSGRSVPSDIFQMQ
ATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPVKGPRTVELDLEMITVNTVI
NFRGSSVIRLRIFVSQYSF
Download sequence
Identical sequences H0ZQN6
ENSTGUP00000012926 ENSTGUP00000012926 59729.ENSTGUP00000012926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]