SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000013067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000013067
Domain Number 1 Region: 61-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-25
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 256-365
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.37e-19
Family Platelet-derived growth factor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000013067
Sequence length 373
Comment (Taeniopygia guttata)
Sequence
LLILLLLYAVVCANFCSRQGTTAPAQSGSIKALRASNIRRDESNHLTDLYRKEETISVAG
NGCIHSPRFPSSYPRNLLLTWRLHSPESTRIQLAFDNQFGLEEPENEICRYDFVEVEDVS
ETSTVIRGRWCGHKEVPPRITSRTNHIKITFKSDDYFVAKPGFKICYSLVDDFQHAASET
NWESVTSSVSGVSYPSPSVTDPTLTAEALDQTIAAFDTVEDLLKHFNPDSWQEDLENLYT
DSGHHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTNVVFFPRCLLVQ
RCGGNCGCGTPNWKSCTCVSGKTVKKYHEVLKFIPEAGHARRRGRIRNNMSLVDIQLDHH
ERCDCVCSSRPPR
Download sequence
Identical sequences H0ZR26
ENSTGUP00000013067 59729.ENSTGUP00000013067 ENSTGUP00000013067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]