SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000013174 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000013174
Domain Number 1 Region: 4-342
Classification Level Classification E-value
Superfamily L domain-like 2.83e-67
Family Ngr ectodomain-like 0.038
Further Details:      
 
Domain Number 2 Region: 790-887
Classification Level Classification E-value
Superfamily PDZ domain-like 9.99e-27
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 937-1029
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-26
Family PDZ domain 0.0054
Further Details:      
 
Domain Number 4 Region: 1030-1128
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-24
Family PDZ domain 0.0000404
Further Details:      
 
Domain Number 5 Region: 655-752
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000434
Family PDZ domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000013174
Sequence length 1495
Comment (Taeniopygia guttata)
Sequence
LSQPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDISRNDIPEIPESIKFCKSLEIA
DFSGNPLSRLPEGFTQLRSLVHLALNDVSLQSLPTDIGNLANLVTLELRENLLKTLPTSL
SFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSEN
KLEQLPNEVSGLVALTDLLLSQNLLECIPDGIGQLKQLSILKVDQNRLTDMTESIGDCEN
LSELILTENMLTALPKSLGKLAKLTNLNVDRNRLTALPAEIGGCANLSVLSLRDNRLALL
PPELANTTELHVLDVAGNRLQNLPFALTNLNLKALWLAENQSQPMLKFQTEDDEKTGEKV
LTCYLLPQQPSPSLENLLQNSVDESWTDTNLNRVSVIQFLDEPKGDDDEESGAERRGLQR
RATPHPSELKVMKKVIEVRRSEVNAAKADANPSSPNSEEKRLSATSNRSEDSHLSTSTAS
LQREGKPRAEEEHKEAADQEEEDVEVEYNEPTVHFAEDTLIRSEDEDEDEERPFPVEKQR
LIRKDTPHYKKHFKITKLPKPEAVVALLQGLNSDGEEELGGCNNNTEPRDQDEAWDEDDR
KNGALSAQPSVKEEGQRRADLPSAPVSRQPGSGVQLWSPAVTGVSFDQANNLLIEPARIE
EEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLER
SGFVPACNEHQVAEKTKKESGSSVSMTVLRERMVEPENTITVTPLRPEEDYSPRERRGGL
RFPEGPEAAPATERFSTCLMRNEKGLGFSIAGGKGSTPYRAGDMGIFISRIAEGGAAHRD
GILRVGDRVISINGVDMTEARHDQAVALLTAASPTIVLLVEREGAEQPGEGGSPRHALPP
AIPRTWDDIIISTPASTVISAAVNQYLSKGLEDQYPVEEIRLVKAGGPLGLSIVGGSDHS
SHPFGIHEPGVFISKVIPRGLASRSGLRVGDRILEVNGIDLRHATHQEAVNALLSNTQEL
SMLVRRDPPPPGMQEICIEKAPGEKLGISIRGGAKGHAGNPFDPTDEGIFISKVSSSGAA
ARDGRLQVGMRILEVNHQSLLGMTHTEAVQVLRGVGDALLVLVCDGFDPKAAAAIEMSPG
IIANPFAAGIGRKNSLESISSIDRDLSPEELEILQKVAGSTLQMFPQLNLAQKQGDEPLR
LDYRTLAALPSSGLQRGNRAAAAGSMQDSSMTPRGPSPPSPPSPDEVPINVKQAYKTFAA
VPLSQPLLGTQVAVHSPGGQHSPEQRSFRERQKYFEIEVKQQHLDKPPKRVSLVGEDDLK
KMKEEEARKLQQQRALLLEEEAEEDEEERQVPEAMQAATAWQVSSRGPTASLSPSLGRLS
PADPGAPVRTAKAERRHQERLRMQSPELLGGQDKELSPAERRALEAEKRAMWRAARMKSL
EQDALKAQMVIAKSKEGKKRSTLEQLAESPSPAPTPSPTPLEDCSPRNVTSPGRL
Download sequence
Identical sequences H0ZRD1
59729.ENSTGUP00000013174 ENSTGUP00000013174 ENSTGUP00000013174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]