SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000013386 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000013386
Domain Number 1 Region: 1006-1094,1123-1345
Classification Level Classification E-value
Superfamily NHL repeat 4.45e-25
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1243-1288,1315-1333,1360-1492
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000000106
Family YVTN repeat 0.046
Further Details:      
 
Domain Number 3 Region: 701-772
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000216
Family Carboxypeptidase regulatory domain 0.088
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000013386
Domain Number - Region: 540-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 411-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000116
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 443-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000277
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 510-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000509
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 577-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 376-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00322
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 1419-1509,1675-1787
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0157
Family Tricorn protease N-terminal domain 0.021
Further Details:      
 
Domain Number - Region: 347-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000013386
Sequence length 2296
Comment (Taeniopygia guttata)
Sequence
PPPISHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEQPATTQEPAHAQDNWL
LNSNIPLETRHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFSRPAFNLKKP
YKYCNWKCAALSAIVISVTLVILLAYFIAMHLFGLNWHLQPMEGQMYEITEDTASSWPVP
TDVSLYPSGGTGVLAGKPSSFFPDDSFIDSGEIDVGRRATQKIPPGIFWRSQVFIDHPVH
LKFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEARSLEGPQRQHRTFVPL
ASHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCVSGTCHC
FLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVSCNNHGTCIM
GTCICNPGYKGESCEEVDCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLDQCSGH
GTFLPDTGLCSCDPNWTGHDCSIEICAADCGGHGICVGGTCRCEEGWMGTACDQRACHPR
CNEHGTCRDGKCECSPGWNGEHCTIAHYLDKVVKEGCPGLCNGNGRCTLDMNGWHCVCQL
GWRGAGCDTSMETACGDGKDNDGDGLVDCMDPDCCLQPLCHVNALCLGSPDPLDIIQETQ
APVSQQSLHSFYDRIKFLIGKDSTHVIPGDNPFEGGHACVIRGQVMTADGTPLVGVNISF
VNNPLFGYTISRQDGSFDLVTIGGISIILHFERAPFITQEHTLWLPWDRFFVMETIVMRH
EENEIPSCDLSNFARPNPVVSPSPLTAFATSCSEKGPIVPEIQALQEEINVSGSKIKVSY
LSSRTAGYKSVLRISMTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDV
YSQKVYGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDKHHALNIQS
GILHKGNGENQFISQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCGSDGSL
YVGDFNYIRRIFPSGNVTNILELRNKDFRHSHSPAHKYYLTTDPITGSIYLSDTNSRRIY
KIKSTTSVKDIVKNSEVLAGTGDQCLPFDDTRCGDGGKGTDATLTNPRGITVDKFGLIYF
VDGTMIRRIDQNGIISTVLGSNDLTSARPLSCDSVMDISQVRLEWPTDLAVNPMDNSLYV
LDNNVVLQISENHQVRIVAGRPMHCQVPGMDHFLLSKVAIHATLESATALAVSHNGVLYI
AETDEKKINRIRQVTTNGEISLVAGAPSSCDCKNDANCDCFSGDDGYAKDAKLNAPSSLA
VCADGELYVADLGNIRIRFIRKNKPFLNTQNLYELSSPIDQELYLFDTSGKHLYTQSLTT
GDYLYNFTYSGDGDITLITDNNGNLVNIRRDSTGMPLWLVVPDGQVYWVTIGTNSALKSV
TTQGHEVAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSS
VHVQVETSSKDDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLMLANGMEVALQTE
PHLLAGTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDF
DRVTRTEKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSPGGHIAGIQRGTMSE
RMEYDQSGRITSRIFADGKSWSYTYLEKSMVLLLHSQRQYIFEFDKNDRLSSVTMPNVAR
QTLETIRSIGYYRNIYRPPEGNASVIQDFTEDEQLLHTLYLGTGRRVIYKYGKLSKLAEM
LYDTTKISFTYDETAGMLKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFDY
NYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTK
HFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDADGQLQ
TVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDLRDRITRLGDVQYKMDEDGFLKQ
RGNDIFEYNSAGLLIKAYNKASGWSVKYRYDGLGRRVSSKTSHGHHLQFFYADLTNPTKV
THLYNHSSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQILYT
AYGEIYMDTNPNFQIIIGYHGGLYDPLTKLIHMGRRDYDVLAGRWTSPDHDMWKHLSSNN
IMPFNLYMFKNNNPISNSQDIKCYMTDVNSWLLTFGFQLHNVIPGYPKPDMDAMEPSYEL
IHTQMKTQEWDNSKVI
Download sequence
Identical sequences H0ZRZ2
59729.ENSTGUP00000013386 ENSTGUP00000013386 ENSTGUP00000013386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]