SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000014177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000014177
Domain Number 1 Region: 106-163
Classification Level Classification E-value
Superfamily RING/U-box 4e-19
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 15-84
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000442
Family PB1 domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000014177
Sequence length 390
Comment (Taeniopygia guttata)
Sequence
MAALTVKAYLLGKEETAREIRRFTLPPPARYRAIYDRVAELFQGLLRAGPPPAFRMHYKD
EDGDLIAFSTDEELEMAMPYVRDGVFRVYIKEKKECKREHRSQCSQEPPRNMVHPNVICD
GCEGPVVGTRFKCSVCPDYDLCSTCEAKGIHKEHNMVMFQSPLLNPFEWLPRGRWLRKMR
HGVPPFPWMHCWGYPGPAAPCQNSEQAEATAAAPSAPAAEAPPQDPNVTFLKNVGESVAA
FLSPLGIEVDIDVEHGGQRSKVTPTSANQEKTSAEATSSAPTQNVQTKADWINVIAEQMQ
DMVVDSVPTQMEDGSFHSQEHSESSSSSGGEEDWTHLSSKEVDPSTGELQSLQMPDTDGP
SSLDVPRDRPTGLREAALYPHLPPEAEPRL
Download sequence
Identical sequences H0ZU80
ENSTGUP00000014177 ENSTGUP00000014177 59729.ENSTGUP00000014177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]