SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000014386 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000014386
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily Chromo domain-like 4.85e-27
Family Chromo domain 0.0000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000014386
Sequence length 83
Comment (Taeniopygia guttata)
Sequence
QSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANLRCPQIVIAFY
EERLTWHAYPEDSEPKERDPPRS
Download sequence
Identical sequences H0ZUT9
59729.ENSTGUP00000014386 ENSTGUP00000014386 ENSTGUP00000014386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]