SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000016059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000016059
Domain Number 1 Region: 583-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000558
Family Laminin-type module 0.0000993
Further Details:      
 
Domain Number 2 Region: 479-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 45-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000301
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 4 Region: 639-687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family Laminin-type module 0.00056
Further Details:      
 
Domain Number 5 Region: 690-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000218
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 157-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0053
Further Details:      
 
Domain Number 7 Region: 206-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 8 Region: 101-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 528-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family Laminin-type module 0.00025
Further Details:      
 
Domain Number 10 Region: 738-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000381
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 842-1053
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000471
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0076
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000016059
Domain Number - Region: 1059-1284
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00719
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Domain Number - Region: 443-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0114
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000016059
Sequence length 1364
Comment (Taeniopygia guttata)
Sequence
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNELG
KLVCNCKHNTFGVDCEKCLPFFNDRPWRRATAESANECLPCDCNGRSQECYFDPELYRAT
GHGGHCTACAGNTDGPRCERCRDSFYRLASDQGCLPCSCNPVGSLSTQCDSYGQCSCKPG
VMGDKCDRCQPGFHSLSEAGCRPCSCNAAGSTGECNVETGRCACKDNVEGFHCERCKPGF
FHLDSSNPRGCTPCFCFGHSSVCTSAVGYSIYSITSNFEFGKIELSFVSQVGLFVQMGRQ
EFTALALSTQLLYSVQVQVGLANRNFFYPERLCFMFWTSSRQRVQSSEDLVLEGAGLRVS
VPLIAHGNSYPSENVQTYTFRLHEAADYPWRPALTAFEFQKLLHNLTSIKIRGTYSERSA
GHLDDVTITSARPGPGVPVAWVESCSCPVGYEGQFCERCTSGYRRETPGLGPYSPCVPCA
CNGHSETCDPETGMCNCRDNTAGTHCEKCSDGYYGDATAGTASDCQPCPCPGTSSCAIVP
RTKEVVCTSCQAGTTGKRCELCDDAYFGDPLGRNGAVRPCRLCQCNNNIDPNAVGNCDRQ
TGECLKCIYNTAGFYCDRCKDGFFGNPLASDPADKCRACHCNPYGTVNHQTICNQVTGQC
ECLSHVTGRDCSACEPGFFNLQSGRGCERCNCHALGSTSGQCDIRTGQCECQPGVTGQQC
DSCESNHFGFGSEGCKPCDCDPEGSRSLQCRENGHCECKEGFVGSRCNQCEENYFYNRSW
PGCQECPACYRLVKDKVAEQRQRLQELENLIANLGTREETVTDEAFEERLKQAEREVTEL
LHEAQKSKDVDQGLMDRLKDINSTLVSQLNRLRNIQGTVQETESLAEQARVRVEDTEDLI
SMASDMLEKAKMAADNVSITPPEQSGDPNNMTLLAEEARKLAERHKKEADEIVRTAKAAN
DTSTEAYQLLLKTLAGENQTAIDIDELNQKYNQARNISRDLEKQANKVLAEAEEAGNRAL
QIYANLTSLPTVDSTGLENKANKIKKEAEELDQLIARKLKDYEDLREDMKGKELEVKNLL
EKGKTEQQTADQLLARADAAKALAEEAARKSSGTLQEANTILRNLKDFDRRVNDNKTAAE
EALKKIPAISQTIAEANNKTHQAELALGNAAADAREAKARADDAEKIASSVQKSAAATRA
EADKTFADVTGLAREVDDMMKQLQDAEKELKRKQADAEQDMKMANEASQAAQEAEDNARK
AKNSVNSLLTVINDLLDQLGQLETVDLNKLNEIEGTLNSAKDQMKDSDLDQKVSFLEREA
KKQDDAIQAYNRDIEEILKDISNLEDIRKTLPSGCFNTPSIEKP
Download sequence
Identical sequences H0ZZK5
ENSTGUP00000016059 59729.ENSTGUP00000016059 ENSTGUP00000016059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]