SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000016567 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000016567
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000179
Family Glutathione S-transferase (GST), C-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000016567
Sequence length 148
Comment (Taeniopygia guttata)
Sequence
QLYREARECLTLLSQRLGSQKFFFGDSPASLDALVFSRLAPLLKAKLPNGKLQQHLKSLQ
NLCNYCTSILSLYFPWDGGESHPPPHPAGWGEAEEDPHKRRKQLLSVLVGLVAMLGYAFL
SGIVSIQRGSVGPAGRQPITLEEEEEEE
Download sequence
Identical sequences H1A106
ENSTGUP00000016567 ENSTGUP00000016567 59729.ENSTGUP00000016567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]