SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000016677 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000016677
Domain Number 1 Region: 41-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000464
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 3-80,123-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000132
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000016677
Sequence length 164
Comment (Taeniopygia guttata)
Sequence
ISNQCSPLPCHKDGYKDCIDGQAKYTCVCKAGWRGENCEEDINECEDFNGGCSQRCSNFP
GSFRCLCEDGYFMHSNKRDCGGRETSGEPPSLPAQCLLTRGREGYFFSLIHPAYFFSVHA
CVCYIDECAENICAQLCVNSPGSYSCYCDGKKGFKLSKDMKNCE
Download sequence
Identical sequences H1A1B5
59729.ENSTGUP00000016677 ENSTGUP00000016677 ENSTGUP00000016677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]