SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000017259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000017259
Domain Number 1 Region: 2-228,303-308
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-86
Family Protein kinases, catalytic subunit 0.000019
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000017259
Domain Number - Region: 242-290
Classification Level Classification E-value
Superfamily UBA-like 0.0102
Family UBA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000017259
Sequence length 390
Comment (Taeniopygia guttata)
Sequence
QVAIKIIDKTRLDPSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEM
FDHLTSNGHLSESEARKKFWQILSAVEYCHSHHIVHRDLKTENLLLDANMNIKLADFGFG
NFYKSGEPLSTWCGSPPYAAPEVFEGKEYEGPHLDIWSLGVVLYVLVCGSLPFDGPNLPT
LRQRVLEGRFRIPYFMSEDCETLIRRMLVVDPAKRITISQIKQHKWMQADPSLQQQQSLC
FSMQNYNSNLGDYNEQVLGIMQTLGIDRQRTVESLQNSSYNHFAAIYYLLLERLKEYWSS
QVSTRPAAGRQPRPRSSEIASAEMPQDSLTSETLRSSLLYQQPQSLIQPSLQAEMDCDIS
NPLQPGVFPVDTTHGLFRNRSTSPTVLLET
Download sequence
Identical sequences H1A2Z7
ENSTGUP00000017259 ENSTGUP00000017259 59729.ENSTGUP00000017259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]