SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000017804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000017804
Domain Number 1 Region: 1004-1097
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-26
Family PDZ domain 0.00025
Further Details:      
 
Domain Number 2 Region: 838-934
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-24
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 3 Region: 393-503
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-24
Family PDZ domain 0.0000541
Further Details:      
 
Domain Number 4 Region: 699-809
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-22
Family PDZ domain 0.00037
Further Details:      
 
Domain Number 5 Region: 556-661
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-17
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 6 Region: 125-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.9e-16
Family Nucleotide and nucleoside kinases 0.0044
Further Details:      
 
Domain Number 7 Region: 293-328
Classification Level Classification E-value
Superfamily WW domain 0.000000000000519
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 339-374
Classification Level Classification E-value
Superfamily WW domain 0.000000000459
Family WW domain 0.003
Further Details:      
 
Domain Number 9 Region: 58-115
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000881
Family PDZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000017804
Sequence length 1171
Comment (Taeniopygia guttata)
Sequence
MSKTLRKKRHWLSKVQECVVSWGGPAGPDPDLLRGGAERGEFPYLAGRLPAGGEGSPGPA
LLSGKAPAPGDVLLEVNGTPVSGLTHRDTLAVVRHFREPVRLKTVRPGKVINKDLRHYLS
LQFQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFIPVEQFKALEESGALL
ESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNDFDTESQRKRTTSVSKMQRMESSLPE
EEEEEEKEAVNGSGGIENKEKHSDSPDWMKPVPSYNQTSSNMDFRNYLSRDETLEPLPKN
WEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYV
DHINQKTQFENPVLEAKRKKQLGQTDAGPSKSGLGRSVFTRDPSQLTGALIRTSLKKSTM
GFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGRIAPGDVIVDINGSCVLGHTHADVVQMFQ
LIPINQYVNMTLCRGYPLPDDSEDPVVDIVTATPVINGLPLAKGDTSVSSQDLVAATVGL
DQNGKVLVNGRLNGPSVDSAEQRVSFASSGGSQPELVTIPLVKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDVIKEICHQNVQSLTHLQVVEVLKQFPVGAEVPLLILRGGPPSP
TKAAKGKDKQDSSGSLEAVSDTIPQPMPFPPSAVRPGSPKLDPSEVYLKSKTIYEDKPPN
TRDLDVFLRKQESGFGFRVLGGDGPDQPIYIGAIIPLGAAEKDGRLRAADELMCIDGVPV
KGKSHKQVLDLMTSAARNGQVLLTVRRKIFFREKQAEEEEPQPVLAQNGSPRLNRVDFAN
QPCPEVYDVRLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADQCGKLKVGDRI
SAVNSQSIVELSHDSIVQLIKDAGNVVTLTVVAEEEQRGPPSGTNSARQSPAPQHRPLGL
ALINPDRGATEGEAGKEVSNSYRLSWPEHKHMAQLDAASGVGSRHSQNAGCFPVELERGP
RGFGFSLRGGKEYNMGLFILRLAEDGPAVKDGRVHVGDQIVEINGEPTQGITHTRAIELI
QAGGNKVLLLLRPGTGLIPDHSDWDSYNPASSNVIYEEQSPLLSSSSHSASPSEVCYLAV
PGEALTRVQLSEELEQAENTVPDKLSTLTEN
Download sequence
Identical sequences H1A4I8
59729.ENSTGUP00000017804 ENSTGUP00000017804 ENSTGUP00000017804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]