SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000018016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000018016
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000433
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000018016
Sequence length 109
Comment (Taeniopygia guttata)
Sequence
DHEELCGTSYGSFCLNGGICYMIPTVSSPFCRCIENYTGARCEEVLLPSIKSQTKGDLFA
AFLASLLLLGVLVIGAFYFLCRKVSIPRTNSSEYGANLVETTSSNGCNS
Download sequence
Identical sequences H1A550
ENSTGUP00000018016 59729.ENSTGUP00000018016 ENSTGUP00000018016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]