SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002155225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002155225
Domain Number 1 Region: 102-157
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-18
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 421-465
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000893
Family UBA domain 0.004
Further Details:      
 
Domain Number 3 Region: 13-91
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000184
Family PB1 domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002155225
Sequence length 467
Comment (Hydra magnipapillata)
Sequence
MSLYEKEVSMKVYYVENQQNKEIRKFSVETQLAANYEYVLGKIRQVFTNLLRKDLDLFYK
DKENDFISISSDIELQQAFESVDNGCLKLYVKKKLTKPAQSNKEHIGVTCDGCNSKIYGN
RFKCTQCFDFDLCSLCYKKGEHPSDHEMLVIKEPRSSKHMYYSQFPFSHCWERYARTNMS
NSCSNKNASNNEENKPTASDQKFDHSQFQKIENNFKEIIKIFESMLGIKIDFYIESCQEK
SDKVEKKEDFSEKLDSLIKVINERFGVPTEQMHTLVDDFIKQCDLKSNGTNSNKDINNSN
NQVFRNNGDMNQANWSDKKDVSLENQLIEKDKEIVNPSDSLCHTNVESVPHLDPNNVSEV
IKEQINPLDTLCPQTSDLQVDSSQEGLGNLIGHLYPQLETQQPSINPANDFIFVDKESID
HKESKLERSLRQMEAMGFDNEGGWLRQLLISKECSIDKVLDALTPAK
Download sequence
Identical sequences 6085.XP_002155225 XP_004206050.1.79663 gi|449665022|ref|XP_004206050.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]