SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002155338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002155338
Domain Number 1 Region: 102-159
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-17
Family ZZ domain 0.0064
Further Details:      
 
Domain Number 2 Region: 359-403
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000306
Family UBA domain 0.0037
Further Details:      
 
Domain Number 3 Region: 12-92
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000196
Family PB1 domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002155338
Sequence length 405
Comment (Hydra magnipapillata)
Sequence
MSLFEKEVHMKVYYVENQHNNEIRKFSVENRMAANYKYILDKIRQVFTNLYEKDLDLFYK
DKENDFISISSDIEFQQAFESINNGCLKLYVKKKLTKPAQSNKEHIGVSCDGCNSKIYGN
RFKCTQCFDFDLCSLCYKKGEHPSDHEMLVIKEPRSSKHMCYSQLPFSHCWERYAHMNTN
NSCSNKNASNNEENKPTASDQKFGVPAEQMHALVDCFIKQCNLKSNERNSDKDINSSNNE
VFRNNGDMNQANFPDKKDVSLENQLINKDKDLVNPSNSLCQTNVESVPHLDPNNVSEVIK
EQINPLESLCQQTSELQVDSSQEGLGNFIGRLFSHLVTQKPPINIANDFELVDKESKDHE
ESKLERSLRQMEAMGFENEGGWLRQLLISKDCNIDKVLDALSPAK
Download sequence
Identical sequences 6085.XP_002155338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]