SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002155527 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002155527
Domain Number 1 Region: 87-148
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-17
Family ZZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 341-385
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000155
Family UBA domain 0.0036
Further Details:      
 
Domain Number 3 Region: 11-92
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000305
Family PB1 domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002155527
Sequence length 387
Comment (Hydra magnipapillata)
Sequence
MSLFEKEVQMKVYYVKNQHNEEIRKLSVEIRMAVNYEYVLDKIRREFTNLLGKDLDLFYK
DKENDFISISSDIELQQAFKSVDNSCLKLYVKIKSAHSNKEHVGVTCDGCDSKIYGNRFK
CTQCFDFDLCSLCYKKGEHPSDHEMLSMLGINVEFFMESSQVKSDETENEESFCKKLNSL
IEVINERFGVDTELMHTLVDNFIKQYNLKCNERNSGADINNSNNEVFRNNGGVNQTNMSN
KNDVSIDKDKDLVKKNCLGSLCHTNVESVPHLDLNNASEVIKKQINPLGSLCPQTSELQV
DSSQEGLANFIGHLYRHLVTQQPPISIANDFELVDKESMDHKESKLERSLKQMEAMGFDN
EGGWLRQLLISKDCNIDKVLDALSPAK
Download sequence
Identical sequences 6085.XP_002155527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]