SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002162601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6085.XP_002162601
Domain Number - Region: 14-81
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00152
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002162601
Sequence length 160
Comment (Hydra magnipapillata)
Sequence
MFEQVNRSLRFVDTSKDDICKSSNLNDLVCFYQGDLVHKRMDAVRKSIFYIRENWNLFKQ
FMNSLQKFFMQDFDIKDIKSHPLSKIFERKRNWCNVEQNTADLPLKEEFSVIHTYTTVEG
FAQIFKIANNIFRDDSSVNLEEKIRNVVFLIELLNIDLFN
Download sequence
Identical sequences gi|221119201|ref|XP_002162601.1| 6085.XP_002162601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]