SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6182.Q5DFM8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6182.Q5DFM8
Domain Number 1 Region: 233-355,386-438
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.38e-27
Family Nucleotide and nucleoside kinases 0.0004
Further Details:      
 
Domain Number 2 Region: 32-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000317
Family Nucleotide and nucleoside kinases 0.011
Further Details:      
 
Domain Number 3 Region: 140-168
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000374
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0029
Further Details:      
 
Weak hits

Sequence:  6182.Q5DFM8
Domain Number - Region: 3-27
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6182.Q5DFM8
Sequence length 445
Comment (Schistosoma japonicum)
Sequence
MMERLLKLLILDRPEDPISYLIKYLEKDIEDVPSIFIFGPKPSGKTFLGSMLSERLQCVM
ISDNDLFSLCSRGKNASLQELTTALTRRLKEPDCESKGYIIVGFPRYENEAKALIHEGVF
PEYAIFLDSPLVTLVERASGEKVDPETGDLYNLIYNPPPNTSVERRLLKIPENDEETIRK
LYSEYSREVVLLKKIYRSVAYEFDADQPISDLYSSVLARVNQRHRSAELMTPKIILLGYP
GAGKHTQANLLAKRYGFIPVNCGQLVLREIAKQSPIGKIMKTYVYKNIPVPDAIIAEAVK
QRLNETDCTTYGWILYGYPRTRQQAELLSSHKLEPTRVIFLDINQSCAFERLSGRRIDPV
SGTSFHILCESAEDVSLSQRGLQNPNDKECVIGPKLSRFTTHRDDIIDYYDSCVIRVHAD
RDIHTVFEEIESAIVNPLPRLNLVK
Download sequence
Identical sequences Q5DFM8
6182.Q5DFM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]