SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG00618 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG00618
Domain Number 1 Region: 35-416
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.6e-63
Family beta-Lactamase/D-ala carboxypeptidase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG00618
Sequence length 423
Comment (Caenorhabditis briggsae)
Sequence
MLYKVAWFIGVALVFVAIRNTNPEREIHVDGDVAKEWSHVADVFKKNLEENWERSGAAFV
VYHKGQKVIDIWGGYSDRESQRKWTRDTLSVAFSCSKAIGAIVIAKLVDEGRMEYDDLVT
KYWPEFGKNGKANVTIRWLITHKAGLAYTDHPIEWEDAIDSKKIDRILADQKPNWPPGTE
IGYHAVTHGWLVDAIVRRVDHKKRTVGQYFREEIGQKFGLDFHLGLPLSEQHRVARIENP
NFWNVLEEIVYAPSDFDVIRFLRDRITNGTLSKTTASTPFIKFVGAMTLNNPDLHRIEQP
AVLGIGTARALAEIFELLRQNKIVSENVKRQMFFENYEMSEDFISGAKVPRGQGFMLKEF
QHRGNPVKMYGHSGYGGQNIRTDFDHEITICYFSNGLKVGFGDTARTYKRLLEVVYDTYF
KLE
Download sequence
Identical sequences A8WNG0
CBG00618 6238.CBG00618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]