SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG06061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG06061
Domain Number 1 Region: 17-121
Classification Level Classification E-value
Superfamily Histone-fold 1.14e-45
Family Nucleosome core histones 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG06061
Sequence length 127
Comment (Caenorhabditis briggsae)
Sequence
MSGRGKGGKAKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK
KTGGDKE
Download sequence
Identical sequences A0A1I7V0I3 A0A260YVN6 A0A2G5VH34 E3LKS0 G0PJN0 G2J745 P09588
CBG01506 CBG05844 CBG05883 CBG06061 CBG10817 CBG23436 CBG23440 CBG23445 B0035.7 F07B7.10 F07B7.3 F08G2.2 F17E9.13 F35H10.1 F45F2.4 F54E12.5 F55G1.10 H02I12.7 K06C4.11 K06C4.3 T10C6.12 T23D8.6 ZK131.10 ZK131.6 CBN02403 CBN04728 CBN04875 CBN08428 CBN09518 CBN10501 CBN12640 CBN13919 CBN14095 CBN16032 CBN16969 CBN18331 CBN20269 CBN21231 CBN21436 CBN21918 CBN23398 CBN24326 CBN25719 CBN26303 CBN28845 CBN29858 CBN31703 NP_492642.1.50509 NP_496887.1.50509 NP_496891.1.50509 NP_496898.1.50509 NP_501201.1.50509 NP_501404.1.50509 NP_501408.1.50509 NP_502131.1.50509 NP_502141.1.50509 NP_502150.1.50509 NP_505198.1.50509 NP_505277.1.50509 NP_505280.1.50509 NP_505293.1.50509 NP_505296.1.50509 NP_507032.1.50509 XP_002633145.1.8413 XP_002633171.1.8413 XP_002633324.1.8413 XP_002635335.1.8413 XP_002636717.1.8413 XP_002636721.1.8413 XP_002636726.1.8413 XP_002639989.1.8413 XP_003088501.1.11157 XP_003107834.1.11157 XP_003109188.1.11157 XP_003109224.1.11157 XP_003110476.1.11157 XP_003110554.1.11157 XP_003114206.1.11157 XP_003114211.1.11157 XP_003115437.1.11157 B0035.7 F07B7.10 F07B7.3 F08G2.2 F17E9.13 F35H10.1 F45F2.4 F54E12.5 F55G1.10 H02I12.7 K06C4.11 K06C4.3 T10C6.12 T23D8.6 ZK131.10 ZK131.6 B0035.7 F07B7.10 F07B7.3 F08G2.2 F17E9.13 F35H10.1 F45F2.4 F54E12.5a F55G1.10 H02I12.7 K06C4.11 K06C4.3 T10C6.12 T23D8.6 ZK131.10 ZK131.6 1173 1181 F08G2.2 F17E9.13 F45F2.4 F54E12.5 F55G1.10 H02I12.7 T10C6.12 T23D8.6 CRE05544 CRE05748 CRE08063 CRE08186 CRE12500 CRE13843 CRE18657 CRE27076 CRE27090 135651.CBN02403 135651.CBN04728 135651.CBN04875 135651.CBN08428 135651.CBN09518 135651.CBN10501 135651.CBN12640 135651.CBN13919 135651.CBN14095 135651.CBN16032 135651.CBN16969 135651.CBN18331 135651.CBN20269 135651.CBN21231 135651.CBN21436 135651.CBN21918 135651.CBN23398 135651.CBN24326 135651.CBN25719 135651.CBN26303 31234.CRE05544 31234.CRE05748 31234.CRE08063 31234.CRE08186 31234.CRE12500 31234.CRE13843 31234.CRE18657 31234.CRE27076 31234.CRE27090 6238.CBG01506 6238.CBG05844 6238.CBG05883 6238.CBG06061 6238.CBG10817 6238.CBG23436 6238.CBG23440 6238.CBG23445 6239.B0035.7 6239.F07B7.10 6239.F07B7.3 6239.F08G2.2 6239.F17E9.13 6239.F35H10.1 6239.F45F2.4 6239.F54E12.5 6239.F55G1.10 6239.H02I12.7 6239.K06C4.11 6239.K06C4.3 6239.T10C6.12 6239.T23D8.6 6239.ZK131.10 6239.ZK131.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]