SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG06160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6238.CBG06160
Domain Number - Region: 226-243,305-366
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0392
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG06160
Sequence length 402
Comment (Caenorhabditis briggsae)
Sequence
MAVPRRPNVQSMRKLLDAKTENEKEVESKDSSVPSLAEICLSSISTTLFRNKIRWRKLTD
LAFEYRYVSEDRNIPKPIQNILCESMDDVLAEAKRWNAKHLEMFVEPAKSRRRVLPKSEL
LRTFYPELVWKRHSCEIDDVATCLHLIKTECKNWPLMQFQFACLYARTELIYDDWKFDNY
RLSCFRKQVGDHPVYDFWLTMMATINKDRHFFGSSIRLPNQKVAQCFLFAIRNGYLQLVE
YIWGQLTDSHREAIGMIEWRNMCYRTRDGEAISFLCKHLCRMNPVGTCRNAWQPFFDAFQ
HLVHDEKSDHLERNQYRRKFEFLLKHCCPILRTRLVKFHHFRLICDAFRYNEHEIFSLLL
QNMSPDDIASAREHIDRIFDRNKTKTGDRLRRTLMRRQQTIQ
Download sequence
Identical sequences A8X0S4
XP_002633399.1.8413 CBG06160 6238.CBG06160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]