SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG07369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG07369
Domain Number 1 Region: 13-52,109-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-23
Family Voltage-gated potassium channels 0.0051
Further Details:      
 
Domain Number 2 Region: 195-308
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-18
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG07369
Sequence length 424
Comment (Caenorhabditis briggsae)
Sequence
MGKKKESMAKCAWMKFRNVLRIALGHLALYCFVVCYVFAGAWVFHQLEGENETELHDKQR
EYAMNLKKDVIAKLATTENVAEINEHLRMFLRNISNLHISLDNYLIFNEPSQVVPKRWTF
PSSVLFSFTILTTIGYGNVTPHTQQCKVFLMIYGAFGIPLFLITIADLGRFSKTAIMALV
QKVSKRELKKQSDEHLLREIAEVMLVAGLFVVFIAIGSAVIPLWENQLTYFDSVYFSYMS
LTTIGLGDIVPRRMDFLLPTLIYITIGLWLTTALVEQLADVFRLVHYAGRQVTNVKGITV
WLGGRRLSMGGLISTVCRRVGMSENLINQINWDRTVIDALDGKMPPTLPIFPWHFTDFLE
HDPPLIDLSIDLDQMDGSFYCSKPLSAKKQRRASQMSAPAIAWMRPQEEARILDADGNFP
NIDA
Download sequence
Identical sequences A8X4X5
CBG07369 6238.CBG07369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]