SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG07401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG07401
Domain Number 1 Region: 10-37,72-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.72e-24
Family Voltage-gated potassium channels 0.0041
Further Details:      
 
Domain Number 2 Region: 176-231
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000929
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG07401
Sequence length 341
Comment (Caenorhabditis briggsae)
Sequence
MNQIDGKSARALLLILSTFTYLLFGAMIFDKLESEDDNRVRDEIERVTERLKNKYNFSER
DMHLFEAIAIKSIPQQAGYQWQFAGAFYFATVVITTVGYGHSAPSTLAGKLFCMIFALFG
IPMGLVMFQSIGERVNTFIAYSLHKFRDNLHQQGYTCLQEVTPTHLLMVSFTIGFLVIVS
VSTIGFGDLVPLQQTNALQEKPLYVFATILFILVGLAVFSACVNLLVLGFMASNADEVTA
ANREPPSAIVLERFARNSLVESQLFNIQKHSTVGVLPGRPRRMYSIVPNSAGDVNIRRQS
TRRSIQDTVCCGCFKPRPPRHRFSLTRRPTNISHLVDLELY
Download sequence
Identical sequences A8X4U9
CBG07401 6238.CBG07401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]