SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG11481 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG11481
Domain Number 1 Region: 406-596
Classification Level Classification E-value
Superfamily Fibronectin type III 2.19e-30
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 246-349
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.33e-20
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 3 Region: 30-62,120-207
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.07e-17
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG11481
Sequence length 629
Comment (Caenorhabditis briggsae)
Sequence
MCGGALLSSGLCRFSELTPGQFGLTKQLVFRLALPHITLLVVSILYAVFGGWMLTLIKYS
QQTAHQSIVFDQTRQSFAKKLAGIGDKEEFEGIVNELVEKAYEFYTMEDGHRWQEAAFNS
NPLTNFTSNLFFAATTLTSIGYGIDAPESLVGRVFCLVYLFFGIPLYLITIADMAKFCTE
LMNRTYTEIIKYKYRVKRRYKRWKSGRIRRYAFPLSIEINSVYSRESMKVGQVIIAGGED
EVAEFLWTHLEHAQFVEVPFLLVIGILLLYIGLSSWIISWVENWNMTDGFYFVMMSVLTI
GFGDLVPRNEIFAVPILFIILAGLVLTTTCVDVVGAYYIDRLHFFGRRLDDDPLSWLKEV
QQRRIEAMKKEAMRKLFETVTALHHIRLTAFKQLTQNYDDHLRSKAPDPPRHLVASHATA
DSVMLRWSAPIYVDEGKRYWYTITYKPRTPQRRNNVVAVDFINKDRYLVTGLKSFTLYEF
SVYVTTRYGQSVPIKVQEYTEPCTVPQSVRIDAISDETATLSWRAPKMNNGPESYIIQFV
QEPAPQFVYWNKYRVGSSTRFTLTDLHADTRYIICVTAEHNHGLAAMSKSMRFRTKKWWG
DEDSTCLRIPGTSHRLSIASAISTLTALR
Download sequence
Identical sequences A8XCW9
6238.CBG11481 CBG11481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]