SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG18302 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG18302
Domain Number 1 Region: 257-308
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 228-257
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000575
Family Somatomedin B domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG18302
Sequence length 454
Comment (Caenorhabditis briggsae)
Sequence
MRQFLFLSILFAIPYTCRAGCYQRRLCCTGRNNTCKVSRKKKILDELVKNERGVDDGISH
LPTVSTIHNEEAQTFHQRPTRVEKEYYSPHYESSGDGYDLIFPDVYDGENDQKIGKLVLP
DVIEMEGSGADKVYERYGLGSGDGEPEPVKEIPLTTAAPSLLTLIFGQKRNQRNPPEEIT
RYSEKPRHLLIRYSLLSKYMPLKVTSSPLLYEESRVQPVNDNLYYLESSVSECYCDEHCV
TLGDCCSDYTFVCPPRDCVLTDWDQWTQCKADNGTCGIGTQKRLRHVIQHAERGGAACPP
LKEMKTCFIDCKPKKSALDDITTVALILDYKYNQTRAKTGRNNIYWDLPNIADKVKKASF
YCVHYSIEWVNRNCVSRLLNKGLTEGSVMCAECQPEATYHRNTGRCASDLDDGDQGFWKL
IGPQSCNGIWTRINRTDNCQCQVQYPQNHPFLLV
Download sequence
Identical sequences A8XSD7
6238.CBG18302 CBG18302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]