SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG23471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG23471
Domain Number 1 Region: 49-77,124-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-20
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Domain Number 2 Region: 236-340
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-16
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG23471
Sequence length 438
Comment (Caenorhabditis briggsae)
Sequence
MAITETVMHKLQFARGIGQREMLRANTLPSITRAKVGCFARLRIYEENARFVLICLILIV
YLAFGAALFHWLEWDNEVDERETIEKRMNEYRENYCTRRPMNECDFDEMVRFIADGATSG
LLNTRPRFDILGSLFFSATVISTIGFGTSTPRTQLGRFITIVYGVVGCTCCVLFFNLFLE
RLVTGMSYILRSLRERKIRYRLKEPGNKPVTLLINNEDFNESSSSCEGHMDNWRPSVYKV
FFILFSMCLVLITASAGVYSVIEDWVYIDSLYFCFISFATIGFGDYVSNQQDVTRMSPDL
YRFVNFCILTLGACFFYCLSNVSSIVVRQLLNWMIKKMDIKVEDRSFLCFKKKRRYMGLG
LRPPKGYDMTSERSSVDYADGLLSLKEFLMNNQSSMIMLQKQLIKSAMKNVVENEEQKIS
ATRVGPMGILDEAFGDEP
Download sequence
Identical sequences A8Y3U3
CBG23471 XP_002636746.1.8413 6238.CBG23471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]