SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.C25E10.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.C25E10.1
Domain Number 1 Region: 5-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.91e-28
Family Nuclear receptor 0.00046
Further Details:      
 
Domain Number 2 Region: 168-385
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000000139
Family Nuclear receptor ligand-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6239.C25E10.1
Sequence length 401
Comment (Caenorhabditis elegans)
Sequence
MHRSTCKICGLAAHGVHFGVTACRACAAFFRRFVVLNLEYECLKDEIKCNLNKIRRSSCR
HCRFQKCLRMGMTADNVQWNRDVYSNEMRYRKLKIQEIRNDENDASIAYPCNSLPSTSLY
PVIKTEDQLYTKSVLSEINYENLERDMHKMFMSDIPSTDHGYFASLSPIYQVVEGLRLIR
KSQQTFDIQFENRLSLETLVPHWREQAKNTAIMSMHSMAFRNIPLTEKSRIFKSLWQNIY
RFERIQMSTEVFGKDCVNEKKLAISCEKAIQLDALFFDIEGVAQNKLTVTLQDYKIFAER
CVREVAQPLSQLKLSIEEVAFLIINFVLHNEEKIIGESLTVCDKFRDQIADGLHEYYKKN
DIINYAPRIKKMMSTIDAMKRIHYDDLAGEFTTNAKNSKDC
Download sequence
Identical sequences Q18155
C25E10.1 NP_505343.1.50509 6239.C25E10.1 C25E10.1 C25E10.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]