SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.C27C7.4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.C27C7.4
Domain Number 1 Region: 14-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-18
Family Nuclear receptor 0.0014
Further Details:      
 
Domain Number 2 Region: 128-324
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000115
Family Nuclear receptor ligand-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6239.C27C7.4
Sequence length 326
Comment (Caenorhabditis elegans)
Sequence
MSTTVGRPSNEIASCQVCHSTERTRLYFGITSCAACAAFFRRSDGIRYMCTATNSCTISH
DMKFFCRACRYTSCIRAGMVMSRNALATARKAPNNIIPREPTPRSVPSLEEVDGFSKILN
ISNGDLLKYYVKEVESIMAQQRYGEQKNALQVKSVNDLMIVTAYQEGTSLESCFNCPGVD
ILYNEDVEVVHKYFKFSNTWIDSLLAPTSPLDPSCNERISEFIHLLKSTLGSTLAQLNLN
IIEYAAFKSFCIWKLVYHKTSISMKIVAQEHYEGVTSALRKYYRKNIKMSELEMATRIGD
ITLQIITVSNLYNDMARMYHQTGLQL
Download sequence
Identical sequences G5EGP2
ZK1025.10 6239.C27C7.4 6239.ZK1025.10 C27C7.4 ZK1025.10 C27C7.4 ZK1025.10 C27C7.4 ZK1025.10 NP_492921.2.50509 NP_492932.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]