SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.C32F10.5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.C32F10.5
Domain Number 1 Region: 197-429
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-74
Family SSRP1-like 0.00000666
Further Details:      
 
Domain Number 2 Region: 549-636
Classification Level Classification E-value
Superfamily HMG-box 1.83e-23
Family HMG-box 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6239.C32F10.5
Sequence length 689
Comment (Caenorhabditis elegans)
Sequence
MTELKFKGVYVEDIGHLTCGTLTLTENSINFIGDKGGKSVYITGTDVDKLKWQKLGNKPG
LRVGLSDGGAHRFGGFLDDDLQKIQSFTSSNWSKSINQSNLFINGWNYGQADVKGKNIEF
SWENEPIFEIPCTNVSNVIANKNEAILEFHQNEQSKVQLMEMRFHMPVDLENEEDTDKVE
EFKKAVLAYAGLEAETEQPICLLTDILCTTPRGRYDIKVYPTSIALHGKTYDYKIPVKTI
NRLFLVPHKDGRQVYFVLSLNPPIRQGQTHYSYLIFEFGKDEEEDLELSLTDEQLDYFNG
NLQREMTGPIYETISILFKSICNLKVTVPGRFLGSSGTPAIQCTHRQNLGLLYPMEKGFL
FIQKPVMYIRFEEISSCHFARSDSGTVTRTFDFEIDLKTGSSLTFSAMDKEENNKLFDYL
NKKEIKIRNSHRIDNKSAGYGSSDEDDIDPYKSTVKAEGREQDDDSDDESTDEDYDLDKD
MKKQKNDKDSSEGSGSEPDDEYDSGSEKDASGTGESDPDEENIEPKKKESKEKKNKREKK
EKPVKEKAVKKGKKTKDPNEPKRATTAYIIWFNANRNSMKEDGDTLGDVAKKAGAKWKSM
SADDKKEWNDKAAQDKARYEAEMKEYKKNGGGVEKASGPSTKKSSDQSPGKQFKSKEHIS
DTDDSDDDEPLKAKKDESDAASESSGESD
Download sequence
Identical sequences O01683
6239.C32F10.5 C32F10.5 NP_491688.1.50509 C32F10.5 C32F10.5 C32F10.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]