SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.C49D10.2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.C49D10.2
Domain Number 1 Region: 136-355
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-38
Family Nuclear receptor ligand-binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 9-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-26
Family Nuclear receptor 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6239.C49D10.2
Sequence length 363
Comment (Caenorhabditis elegans)
Sequence
MSEPPKKPFACAICRNKSSGCHYGVLSCDACKMFFKRTYLMEKYYTCRRQESCYNMDGGN
RKCKACRFKKCLEVGMNPELFSRSESQIISTNIPTQLITQDHRNAEFLQKLKILDKTRHE
VFKIIDTYENPSFVDLVRQESRLSCYLRPKNISWENTERKLKPWGSLGMLLAVETIKSLD
FYPKLLLSDRILLLETVTLKSFHLSVAFDSFSQKKEKILAPDGSEMFPDSLNKMDFCKDL
IMRLLTTPVKPLIAMKLTETEYLLLGIIVICNPEIDGLSPSGKAIITAFLQKTINVLLQF
CLINNPRSAPSRLLEIISINQILNRQFHASYKLFDALRKQWDPTMSFQKVLVESCKTRGY
DLS
Download sequence
Identical sequences O16609
NP_494682.1.50509 C49D10.2 C49D10.2 C49D10.2 6239.C49D10.2 C49D10.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]