SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.F33C8.1a from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.F33C8.1a
Domain Number 1 Region: 337-600
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-44
Family Kelch motif 0.01
Further Details:      
 
Domain Number 2 Region: 91-205
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-18
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 945-1000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000226
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  6239.F33C8.1a
Domain Number - Region: 997-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000474
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 208-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 63-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0122
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6239.F33C8.1a
Sequence length 1329
Comment (Caenorhabditis elegans)
Sequence
MLGNITPVSFFKTWVLKKTDVHVMISAREVFPCFIFRVFLLFQVFSRVHTLTNHANFEFE
KSLSSCDKPCYNGVCLNKACVCSKGWYGSQCDHCFGRIRISDNASYISDGPLDYSPSAKC
TWLIEPENSATPLKIRINSFFTECGWDYLYIYDGDSVYGKQLAALCGEQPSQEFTAASGK
ALVHFFSDLAINLNGFNVSYESNRCAYNCSNHGSCLNGKCDCEDGYKGLNCEYQVCQLSG
KSTESPCHEGQCVDGRCECLSARVHGETCQMPVSSSVWDLIHPTNNAPTGKASHASIAID
DVVWSIGGEFFDGSSDPNNIDVYNVTSRIWSKVEVSGDMPKPRFDHTVVKYKNKLYMFGG
VTKTQVRHQTTQAATNELWIFDMGSKKWAQQIHKNETIIAAPFAVAGHSAHVIRSEMFVI
FGYNPLFGFMHHVQIYNFETEEWTVANTSDHVYGRFKHSAVEYTTPTGATAILVYGGSMW
NNTITDSLMQFDTSTKKWSNLPQSGVQLYLHAAAYLNGLMVVVGGRGSNVTAGSKSECFS
NMVQSYDVACKQWSNMSTAPVDLKRFGHSVHVIGQKLYALGGFNGKMKSDVWTLSPAKCS
SATRPDECRLITDGTKCVFVDSSCVPFDPTVSYKSSFASMIKSSTPKSFDECTNTPLRLA
LKTCEEQTDCVSCASKSGCGWCSSGEQCLPNEQECVDGPGMLTSWEKCPQRNSVATMRPC
NMENNCGSCRISPHCTWYPIDKASPCVSKEDLSPAFFLVHSRRKGKNRDPNQYQAADMSR
VPRAAAFNSLAVVYEYETKSVLADRNKFLSPSHFPSFFRNATECPMPCAQRNNCSDCTDL
EQCMWCPSTNRCINLEAYTLSFAYGQCHSWVTSGSGSVINRVCQAESVVCEEHKTCGECQ
RDPGCGWLADDSKTGLGLCIRGTSTGPLEPKPENSTWYFIDCPACQCNGHSTCFTSVGSF
PPVTIEKCQSCQNHTTGAHCERCAPGFYGDARNGGVCSPCDCHHQADMCDPVSGQCFCKT
KGVTGDRCDKCEAKYVGNPRNGTPCFYELAVDFIFTFKLRSDDKDNHTSEIYLYSVPYKK
DTDVTFQISCESPKGNALVALNMTSSYVNGLADKSQAMMVDTICDSKGFRRVYVASDKGY
PFGPDSNTTFFVRVYNFNTPVQIVVSFAQSPPINWVLFFVIFAACFIVLLVVAGLLWMIK
VRIEAYRRNQRRIDEIEHMASRPFASTKMELSMLSQFSSAGGPTPLSIEPCSNYRAGVFT
LAVRLPTGGKAVTPSGTSGLAVASSLCLLTPQQVGVLQAQDNGESNSGRKSNFRNLLRLT
IRQRPNNND
Download sequence
Identical sequences Q19981
NP_001024625.2.50509 F33C8.1a F33C8.1a 6239.F33C8.1a F33C8.1a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]