SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.F44C8.2.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.F44C8.2.1
Domain Number 1 Region: 161-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.05e-37
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 10-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-25
Family Nuclear receptor 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6239.F44C8.2.1
Sequence length 407
Comment (Caenorhabditis elegans)
Sequence
MPAPLFLSGPCEICGQKTSGRHFGVMSCRSCAAFFRRAATCSRIFGRCPNGNCKLLENGK
FKCKKCRMKRCLEVGMDETKFQCNRDLISSSNKFQKRVSLIEPPPQSLSTFLGRPTLLLC
CEPTRASHIKTLINVTYMVDVARDILKRDVSTKIPYQFHNSLERLALSLEEIRSREPDEK
IKMLRKIGQEESLLIWEQAFLRAVEWFSNFSEFNALDELSKMTILKSAWISWTRLEKLAE
TADHQRKKIFGDSVMMCGNDACLDLANYEVDLTWCTNYTTEQLLFYLSPEIEQNHFLSLQ
ELVELNPTSTELSYMLLQITLHLAGKKAQGQLLEITEMLLEAQGNHLHEYYVKKLKMPNY
VMRLAKLMKINRRIESDMRDRVEKNHIARIFNILKVEFSEPDMFEST
Download sequence
Identical sequences O16361
F44C8.2 F44C8.2.1 6239.F44C8.2.1 NP_503610.1.50509 F44C8.2 F44C8.2.1 F44C8.2.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]