SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.M116.5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.M116.5
Domain Number 1 Region: 23-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.78e-77
Family Calponin-homology domain, CH-domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 468-638
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000188
Family Calponin-homology domain, CH-domain 0.00085
Further Details:      
 
Domain Number 3 Region: 302-452
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000546
Family Calponin-homology domain, CH-domain 0.00088
Further Details:      
 
Domain Number 4 Region: 859-917
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.000000000000602
Family GAS2 domain 0.0019
Further Details:      
 
Weak hits

Sequence:  6239.M116.5
Domain Number - Region: 652-761
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6239.M116.5
Sequence length 1064
Comment (Caenorhabditis elegans)
Sequence
MVGEKNRSQHKIDPSDAQEKDILDHYELNRGKFNDVRDTMQKKTFTKWVNKHLTKTDHTI
VDLFVDLRDGFALIALLEALTGERIQRENGYTRFHRIQNVQYCLDFLKMKNIKLVNIRPE
DIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQTNEKHTTNSQDSIHRSETTSA
RDALLQWAKRTTAEYPRGNVINFSNSWRDGLAFNAIIHRYRSSAIDWNKINSDSVSNTER
LNIAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPQEPEMSKFAASGGKR
LEEEIGKLQADADHIFEALAVISKDEALQESPSLLLVSKQVSKKIEQLKVLLKLVEEKKD
TFISKCKLVMRTAGPESDAKELDSLMKHVEDAYSDINSDSVPNTESLNLAFAAADPEFGA
GRLLDAEDVDTNNNPDEKPVITYVSSLKNAPQDPEMSRLAASGGKGFEEEIGKLQADADH
IFEALAVMSKDEALQESPSLLLYSKQIRFNKIQKLKELLKPVEEKKDTFISECKLVMKTA
GPEADTKELDSLLKQVEDAYSDVFELISDKEGLIDRCNASNINSDSVSNTERLNIALAAA
DAEFGAGRLLDAEDVDTNNNPDEKSIITYVSSLNNAFPLEPEMSKYVASGGKRLEEEIGK
LQADADHIFKALEEISKDEALQESPSLLLDSKQVSKKIEQLKVLLKPVEEKKDTFISESK
LVMKTVGPESDAKELDSLMKHVEDAYSDVVELISDKEGLIDRCNASNRIAHPQTETEKIT
NEIELLKETCSCCTPYQIEKISENYYRRSKSNFRGYYFSKKQSKKQCFFFSKIRIIKNFM
TAQNFKKKILLKSQSLSSFSCLSMGRKLFFFGDTHIKRMVRILRSTVMVRVGGGWEPLEE
SLQKHDPCRTKGRLNINMFPEARPIHALDLMQSFTKNRHAKQMPIAGTPGPIMKIREKTE
RSVPMSGGLGGTAGYTVTTESPRKTPQRPFRIPRTPSDKTPGRQSRVGCVSNLKNSIVEP
SSPSQSESRASPEVADRQKRISLSLKEKGKRYSPQVGPSSSTPK
Download sequence
Identical sequences 6239.M116.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]