SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.R04B5.4b from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.R04B5.4b
Domain Number 1 Region: 188-452
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.1e-36
Family Nuclear receptor ligand-binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 46-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.91e-27
Family Nuclear receptor 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6239.R04B5.4b
Sequence length 456
Comment (Caenorhabditis elegans)
Sequence
MEQIPQEQKTEPFLASFTTTEKLGTETPTTSITPNTQFRGRYEKPNCAVCNEVGDGLHFG
AEACRACTAFFRRSVALSKKYECRAGRNCEVSSNIRCMCRSCRYDKCIEVGMNPECVQNR
RENDTPKADLQFDTSKTEIRRPIPNFNIVPQASAVPSTSNFMDFSIFKDTPISNFSAFSP
ASLPGLSSSPSLETMPLLERMRINYDKMENARNVIHRREGENIFQQKVPRAITFREATEV
TTKEVSLVADWIEWCFDDFGLLPVDQKTILFQNFFVFFCMLERAFMTVKSGRDGIVVMAS
KDYIDYDNLEGFFKECNSGTGGTPAEIAKLCRLIRPSFELQKRSLINLMRLENVDSYEFF
ALCVMLFWDFGLEGQSDECNEVGRRVKHRVTREMTFYLRNVKKHEEPLYRMASVVSILPS
LQRAVRRFQEDIEMANIFNIYALPENFVNIINGKFN
Download sequence
Identical sequences A5JYT1
R04B5.4b NP_001122983.1.50509 6239.R04B5.4b R04B5.4b R04B5.4b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]