SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.R17.3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.R17.3
Domain Number 1 Region: 243-294
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 214-244
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000418
Family Somatomedin B domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6239.R17.3
Sequence length 440
Comment (Caenorhabditis elegans)
Sequence
MRHFLFVSLVFSIPYTCHAGCYQRRLCCAGRNNTCKGVDDGIAHLPTVSTIHNEEAQTFH
QRPTVRTEKEYYTPHYESSGDGYDLIFPDVFDEESDERIGKLVLPDIIEMDGSGADKVYE
RYGLGSGDGEPEDVETQEIPLTTPAPRLKTLIFGLKRDQRTPPEEITRYSEKPRHLLIRY
SLLSKFMPLKVTSTPLLYEENRVQPANNLYYLESSISECYCDEHCVTLGDCCSDYTFVCP
PRDCVLTDWDSWTQCTADNGTCGIGTQKRLRHVIQHAERGGAACEPLKEMRTCFVECRPK
KSALDDITTVALILDYRHNKTRSKIRRNNIYWDLPNVAEKMKKATYYCVHYTIDWVNRNC
VSRLLNKGLSEGSVMCAECQPEATYHRNNGRCASDLEDGDQGFWKLIGPQSCNGIWTRIN
RTENCQCQIEYPKDHPFLLV
Download sequence
Identical sequences O18003
R17.3 NP_499387.1.50509 R17.3 R17.3 6239.R17.3 R17.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]