SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.T07C5.4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.T07C5.4
Domain Number 1 Region: 111-300
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-19
Family Nuclear receptor ligand-binding domain 0.018
Further Details:      
 
Domain Number 2 Region: 14-79
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000295
Family Nuclear receptor 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6239.T07C5.4
Sequence length 301
Comment (Caenorhabditis elegans)
Sequence
MVVTTGKRLPRLFCTGKDFKTNACNACGTFFRRELKRTRYIDDWRHDEHCFKNYHTASIS
KCMFCRFHKCVDVGMLQIFQYSQLEKLISSLTLLDSTKESTFYYSTKIVPIDFHLDNLFE
QESLKYLDKPAGLHFECFDWGLMSQITAIEYLKNLHFTKFLSSRDLKNFLSNSNFSLIVL
TTNMASYMRKQSFVSFPNGADVYPSFVVNDSFISQNLLNKVRSISGLSNTGRDLIASYQK
VYTSSLLELCFKTHKKKAFTICRFLCVFNLVMKVHEHTKKYLTLFQYFYPNQPTSKMILE
L
Download sequence
Identical sequences T07C5.4 T07C5.4 T07C5.4 6239.T07C5.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]