SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.VC5.6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.VC5.6
Domain Number 1 Region: 130-363
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.43e-32
Family Nuclear receptor ligand-binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.9e-24
Family Nuclear receptor 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6239.VC5.6
Sequence length 386
Comment (Caenorhabditis elegans)
Sequence
MDITELECLVCKAPSTEPHYGADVCRACAAFFRRRVFSRFPATCDQLGSCEITGEREVRQ
CKACRMEKCLQIGMRISNVQSKRDKHDNDKLKKKDEVSEKALVPACYSKVSILPNELQCS
STYDYNNMRLKSLHLNFTEMLQIRKVRFPKRRATKTLHHAEALTIFRKDVRLVVDWINHT
FPEFSRVLEPDQQRILFRNFYMKWTVFEPAYLAVLLGKPDTYHLPTGDIVDEVGVYYTRH
LCTPTSYSLDEVSRIFSPYWADFRKTLVDPVIDAKLSIHEFLLLCAICLFDIGLDYQSDD
CIEFCQTIRQELFRELNAVCKQLCSSNSEDYCFRFSKNMLLLPSIQRGIDVLEEELQLGG
LYKLIATRTDDWYSMVDGPNFKKNEG
Download sequence
Identical sequences Q2V068
VC5.6 NP_001041174.1.50509 VC5.6 6239.VC5.6 VC5.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]