SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.W01A11.3a from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6239.W01A11.3a
Domain Number - Region: 132-217
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00752
Family Spectrin repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6239.W01A11.3a
Sequence length 1041
Comment (Caenorhabditis elegans)
Sequence
MDVMDSFSEVEMPNDISSEDHLLKVIESSAEEVDIFLENCSSLYNLILDSLHNLTSKTIS
CECLDEMTSTLEKSAKKILAERPEAENSVLLRLNTICCAMDQLRVQHNSRMMSGADSDTA
SSARSSTSSSTGEMRLWLHEVERRLEINEKRIRVEPNLQLLLSDQQALQLEIQHEGQLLV
NRLNKQIKDDHDSDSSEEEKRKTCVDAIRKRWHTIYLNSLSLVCRIEELINHQQASEDSE
SDPDLVGPPIKRARIRTVGHLTASDTEESEADEEDRHSQTETVVTEDDNVLPFAENEYES
IMDGRVTVDSCTSSSEDQMVEQSTNKKWESVLQDVGYSSGENSIHEALNTCADHLVPETS
DMRRKRIECSPVKAFYRTVQLEDMSDLEVTKAINHDVEEEPNLSDSMYVNHDSTFLATQN
LPEYDEVMALMDDDDLPMDMSMTESFNTKWREIHGQKKPLRRASRPSREQMNLIAKSSCD
ASSEDSSEGENQTNLEDDPEMMSVSFNSAQFDTSSPLKRQRSARGLKNASFLYDSLEMDG
SFCSTRSEMLPPCKTRSLARRKLRVRRMPRSMSDGEQLGVVSSKPEGMMTPMIRVSPPST
PVRRLLRKLDEQIRNRDSDTAPEHSDAAQAYEWDEYNPPQKDDSISDRHIQTMTDISDQL
MNIDDDFAEHFGTSSAIRLIEESKSHLRVVLKALEESDSNIPQLSNFELIARSNLRQVDE
ALKIQSGNQPSFLETSTLQDLRSEWANLYESIRSPFARIMHQVKKFAATLQEVSSMASLG
DVDIRSKEDVAKTLDAVTAIERRLSSERQELRDLLASSSFRDVAKDLSCEFESVSEGYDD
AVDKIGKMAHSLSQVKGEWDAWNSRQNDIRNAMVRIESHLKEGQMDNKMIADEMELCQER
MNSLETMCNYLTASLGSIQNESNSKNLPDFKAELSIYSNALARLKDRFNDMIRVPTPPTV
QFHPPEPLPSLARSMTTQTAEMESETENEPLTIAEAISSSRLIKFTFALSLLAALAAIFY
YHVFGKPFGPHVTYVNGPPPV
Download sequence
Identical sequences Q23064
W01A11.3a 6239.W01A11.3a W01A11.3a W01A11.3a NP_001076749.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]